SHB monoclonal antibody (M07), clone 4C11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
SHB monoclonal antibody (M07), clone 4C11. Western Blot analysis of SHB expression in human kidney.
Western Blot (Tissue lysate)
SHB monoclonal antibody (M07), clone 4C11. Western Blot analysis of SHB expression in rat brain.
Western Blot (Cell lysate)
SHB monoclonal antibody (M07), clone 4C11. Western Blot analysis of SHB expression in 293.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SHB is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (38.83 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SHB.
Immunogen
SHB (NP_003019.2, 348 a.a. ~ 446 a.a) partial recombinant protein with GST-pstS1 tag.
Sequence
GKGESAGYMEPYEAQRIMTEFQRQESVRSQHKGIQLYDTPYEPEGQSVDSDSESTVSPRLRESKLPQDDDRPADEYDQPWEWNRVTSPALAAQFNGNEK
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.83 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SHB monoclonal antibody (M07), clone 4C11. Western Blot analysis of SHB expression in human kidney.Western Blot (Tissue lysate)
SHB monoclonal antibody (M07), clone 4C11. Western Blot analysis of SHB expression in rat brain.Western Blot (Cell lysate)
SHB monoclonal antibody (M07), clone 4C11. Western Blot analysis of SHB expression in 293.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SHB is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — SHB
Entrez GeneID
6461GeneBank Accession#
NM_003028.2Protein Accession#
NP_003019.2Gene Name
SHB
Gene Alias
RP11-3J10.8, bA3J10.2
Gene Description
Src homology 2 domain containing adaptor protein B
Omim ID
600314Gene Ontology
HyperlinkOther Designations
OTTHUMP00000021397|SHB (Src homology 2 domain containing) adaptor protein B|SHB adaptor protein (a Src homology 2 protein)
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com