Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SH3GL3 (Human) Recombinant Protein (P01)

  • Catalog # : H00006457-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SH3GL3 full-length ORF ( AAH42864.1, 1 a.a. - 288 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSVAGLKKQFHKASQLFSEKISGAEGTKLDDEFLDMERKIDVTNKVVAEILSKTTEYLQPNPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNGVSTTSVVKTTAYSRLEPAD
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 59
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006457-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • 1.
  • LRRK2 Controls an EndoA Phosphorylation Cycle in Synaptic Endocytosis.
    Matta S, Van Kolen K, da Cunha R, van den Bogaart G, Mandemakers W, Miskiewicz K, De Bock PJ, Morais VA, Vilain S, Haddad D, Delbroek L, Swerts J, Chavez-Gutierrez L, Esposito G, Daneels G, Karran E, Holt M, Gevaert K, Moechars DW, De Strooper B, Verstreken P.Neuron. 2012 Sep 20;75(6):1008-21. doi: 10.1016/j.neuron.2012.08.022.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6457
  • Gene Name:
  • SH3GL3
  • Gene Alias:
  • CNSA3,EEN-2B-L3,EEN-B2,HsT19371,SH3D2C,SH3P13
  • Gene Description:
  • SH3-domain GRB2-like 3
  • Other Designations:
  • -
  • Gene Pathway
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook