SH3GL2 monoclonal antibody (M01), clone 5A6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SH3GL2.
Immunogen
SH3GL2 (NP_003017, 64 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMREL
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (32.45 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SH3GL2 monoclonal antibody (M01), clone 5A6 Western Blot analysis of SH3GL2 expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SH3GL2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SH3GL2 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — SH3GL2
Entrez GeneID
6456GeneBank Accession#
NM_003026Protein Accession#
NP_003017Gene Name
SH3GL2
Gene Alias
CNSA2, EEN-B1, FLJ20276, FLJ25015, SH3D2A, SH3P4
Gene Description
SH3-domain GRB2-like 2
Omim ID
604465Gene Ontology
HyperlinkOther Designations
Endophilin A1 BAR domain|OTTHUMP00000021084|bA335L15.1 (SH3-domain GRB2-like 2)
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Cancer Testis Antigen Promotes Triple Negative Breast Cancer Metastasis and is Traceable in the Circulating Extracellular Vesicles.
Kannan A, Philley JV, Hertweck KL, Ndetan H, Singh KP, Sivakumar S, Wells RB, Vadlamudi RK, Dasgupta S.
Scientific Reports 2019 Aug; 9(1):11632.
Application:IP, IP-WB, WB-Tr, Human, SUM-159, MDA-MB-231, MCF-7, HMLE cells.
-
SH3GL2 is frequently deleted in non-small cell lung cancer and downregulates tumor growth by modulating EGFR signaling.
Dasgupta S, Jang JS, Shao C, Mukhopadhyay ND, Sokhi UK, Das SK, Brait M, Talbot C, Yung RC, Begum S, Westra WH, Hoque MO, Ping Y, Yi JE, Lam S, Gazdar AF, Fisher PB, Jen J, Sidransky D.
Journal of Molecular Medicine 2013 Mar; 91(3):381.
Application:IHC, IP-WB, WB-Ce, Human, Squamous cell carcinoma, H1299, H1437, H1944 cells.
-
Cancer Testis Antigen Promotes Triple Negative Breast Cancer Metastasis and is Traceable in the Circulating Extracellular Vesicles.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com