Product Browser

Last updated: 2017/4/23
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SH3GL1 polyclonal antibody (A02)

  • Catalog # : H00006455-A02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SH3GL1.
  • Immunogen:
  • SH3GL1 (NP_003016, 12 a.a. ~ 119 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • KASQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVTEVLARTIEYLQPNPASRAKLTMLNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006455-A02
    Western Blot detection against Immunogen (37.99 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SH3GL1 polyclonal antibody (A02), Lot # 060516JCS1 Western Blot analysis of SH3GL1 expression in SJCRH30 ( Cat # L027V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6455
  • Gene Name:
  • SH3GL1
  • Gene Alias:
  • CNSA1,EEN,MGC111371,SH3D2B,SH3P8
  • Gene Description:
  • SH3-domain GRB2-like 1
  • Other Designations:
  • SH3 domain GRB2-like 1,SH3-containing Grb-2-like 1 protein,SH3-containing protein EEN,extra 11-19 leukemia fusion,fusion partner of MLL
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook