ITSN1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ITSN1 partial ORF ( NP_003015.2, 588 a.a. - 675 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
EVEKETRSKLQEIDIFNNQLKELREIHNKQQLQKQKSMEAERLKQKEQERKIIELEKQKEEAQRRAQERDKQWLEHVQQEDEHQRPRK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.42
Interspecies Antigen Sequence
Mouse (85); Rat (89)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ITSN1
Entrez GeneID
6453GeneBank Accession#
NM_003024Protein Accession#
NP_003015.2Gene Name
ITSN1
Gene Alias
ITSN, MGC134948, MGC134949, SH3D1A, SH3P17
Gene Description
intersectin 1 (SH3 domain protein)
Omim ID
602442Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cytoplasmic membrane-associated protein that indirectly coordinates endocytic membrane traffic with the actin assembly machinery. In addition, the encoded protein may regulate the formation of clathrin-coated vesicles and could be involved in synaptic vesicle recycling. This protein has been shown to interact with dynamin, CDC42, SNAP23, SNAP25, SPIN90, EPS15, EPN1, EPN2, and STN2. Multiple transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two of them have been characterized so far. [provided by RefSeq
Other Designations
OTTHUMP00000067855|SH3 domain protein-1A|Src homology 3 domain-containing protein|human intersectin-SH3 domain-containing protein SH3P17|intersectin 1|intersectin 1 short form variant 11|intersectin 1 short form variant 3|intersectin short variant 12
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com