Product Browser

Last updated: 2017/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ITSN1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00006453-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ITSN1 partial ORF ( NP_003015.2, 588 a.a. - 675 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • EVEKETRSKLQEIDIFNNQLKELREIHNKQQLQKQKSMEAERLKQKEQERKIIELEKQKEEAQRRAQERDKQWLEHVQQEDEHQRPRK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.42
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006453-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6453
  • Gene Name:
  • ITSN1
  • Gene Alias:
  • ITSN,MGC134948,MGC134949,SH3D1A,SH3P17
  • Gene Description:
  • intersectin 1 (SH3 domain protein)
  • Gene Summary:
  • The protein encoded by this gene is a cytoplasmic membrane-associated protein that indirectly coordinates endocytic membrane traffic with the actin assembly machinery. In addition, the encoded protein may regulate the formation of clathrin-coated vesicles and could be involved in synaptic vesicle recycling. This protein has been shown to interact with dynamin, CDC42, SNAP23, SNAP25, SPIN90, EPS15, EPN1, EPN2, and STN2. Multiple transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two of them have been characterized so far. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000067855,SH3 domain protein-1A,Src homology 3 domain-containing protein,human intersectin-SH3 domain-containing protein SH3P17,intersectin 1,intersectin 1 short form variant 11,intersectin 1 short form variant 3,intersectin short variant 12
  • RSS
  • YouTube
  • Linkedin
  • Facebook