ITSN1 monoclonal antibody (M02), clone 2F12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ITSN1 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.42 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ITSN1.
Immunogen
ITSN1 (NP_003015.2, 588 a.a. ~ 675 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EVEKETRSKLQEIDIFNNQLKELREIHNKQQLQKQKSMEAERLKQKEQERKIIELEKQKEEAQRRAQERDKQWLEHVQQEDEHQRPRK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85); Rat (89)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.42 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ITSN1 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — ITSN1
Entrez GeneID
6453GeneBank Accession#
NM_003024Protein Accession#
NP_003015.2Gene Name
ITSN1
Gene Alias
ITSN, MGC134948, MGC134949, SH3D1A, SH3P17
Gene Description
intersectin 1 (SH3 domain protein)
Omim ID
602442Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cytoplasmic membrane-associated protein that indirectly coordinates endocytic membrane traffic with the actin assembly machinery. In addition, the encoded protein may regulate the formation of clathrin-coated vesicles and could be involved in synaptic vesicle recycling. This protein has been shown to interact with dynamin, CDC42, SNAP23, SNAP25, SPIN90, EPS15, EPN1, EPN2, and STN2. Multiple transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two of them have been characterized so far. [provided by RefSeq
Other Designations
OTTHUMP00000067855|SH3 domain protein-1A|Src homology 3 domain-containing protein|human intersectin-SH3 domain-containing protein SH3P17|intersectin 1|intersectin 1 short form variant 11|intersectin 1 short form variant 3|intersectin short variant 12
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com