SH3BP2 monoclonal antibody (M01), clone 1E9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SH3BP2.
Immunogen
SH3BP2 (AAH22996, 452 a.a. ~ 561 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PLPNSVFVNTTESCEVERLFKATSPRGEPQDGLYCIRNSSTKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHYHTHVLPSHQSLLLRHPYGYTGPR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (95)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SH3BP2 monoclonal antibody (M01), clone 1E9 Western Blot analysis of SH3BP2 expression in A-431 ( Cat # L015V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SH3BP2 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to SH3BP2 on A-431 cell. [antibody concentration 20 ug/ml] -
Gene Info — SH3BP2
Entrez GeneID
6452GeneBank Accession#
BC022996Protein Accession#
AAH22996Gene Name
SH3BP2
Gene Alias
3BP2, CRBM, CRPM, FLJ42079, RES4-23
Gene Description
SH3-domain binding protein 2
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene has an N-terminal pleckstrin homology (PH) domain, an SH3-binding proline-rich region, and a C-terminal SH2 domain. The protein binds to the SH3 domains of several proteins including the ABL1 and SYK protein tyrosine kinases , and functions as a cytoplasmic adaptor protein to positively regulate transcriptional activity in T, natural killer (NK), and basophilic cells. Mutations in this gene result in cherubism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
SH3BP2 Deficiency Ameliorates Murine Systemic Lupus Erythematosus.
Kyoko Kawahara, Tomoyuki Mukai, Masanori Iseki, Akiko Nagasu, Hajime Nagasu, Takahiko Akagi, Shoko Tsuji, Sumie Hiramatsu-Asano, Yasuyoshi Ueki, Katsuhiko Ishihara, Naoki Kashihara, Yoshitaka Morita.
International Journal of Molecular Sciences 2021 Apr; 22(8):4169.
Application:WB-Ti, WB-Tr, Mouse, Mouse lympho node, Mouse spleen.
-
Alveolar bone protection by targeting the SH3BP2-SYK axis in osteoclasts.
Kittaka M, Yoshimoto T, Schlosser C, Rottapel R, Kajiya M, Kurihara H, Reichenberger EJ, Ueki Y.
Journal of Bone and Mineral Research 2020 Feb; 35(2):382.
Application:WB, Mouse, Mouse lympho nodes.
-
Reciprocal stabilization of ABL and TAZ regulates osteoblastogenesis through transcription factor RUNX2.
Matsumoto Y, La Rose J, Kent OA, Wagner MJ, Narimatsu M, Levy AD, Omar MH, Tong J, Krieger JR, Riggs E, Storozhuk Y, Pasquale J, Ventura M, Yeganeh B, Post M, Moran MF, Grynpas MD, Wrana JL, Superti-Furga G, Koleske AJ, Pendergast AM, Rottapel R.
The Journal of Clinical Investigation 2016 Dec; 126(12):4482.
Application:WB, Mouse, Mouse osteoblasts.
-
SH3BP2 Deficiency Ameliorates Murine Systemic Lupus Erythematosus.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com