Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SGCG (Human) Recombinant Protein (Q01)

  • Catalog # : H00006445-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SGCG partial ORF ( NP_000222.1, 191 a.a. - 290 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • DLRLESPTRSLSMDAPRGVHIQAHAGKIEALSQMDILFHSSDGMLVLDAETVCLPKLVQGTWGPSGSSQSLYEICVCPDGKLYLSVAGVSTTCQEHSHIC
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006445-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6445
  • Gene Name:
  • SGCG
  • Gene Alias:
  • A4,DAGA4,DMDA,DMDA1,LGMD2C,MAM,MGC130048,SCARMD2,SCG3,TYPE
  • Gene Description:
  • sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein)
  • Gene Summary:
  • This gene encodes gamma-sarcoglycan, one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin. The dystrophin-glycoprotein complex (DGC) spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Defects in the encoded protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C). [provided by RefSeq
  • Other Designations:
  • 35kD dystrophin-associated glycoprotein,OTTHUMP00000018112,gamma sarcoglycan,sarcoglycan, gamma (35kD dystrophin-associated glycoprotein)
  • RSS
  • YouTube
  • Linkedin
  • Facebook