Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Disease

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SGCG MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00006445-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human SGCG protein.
  • Immunogen:
  • SGCG (NP_000222.1, 1 a.a. ~ 291 a.a) full-length human protein.
  • Sequence:
  • MVREQYTTATEGICIERPENQYVYKIGIYGWRKRCLYLFVLLLLIILVVNLALTIWILKVMWFSPAGMGHLCVTKDGLRLEGESEFLFPLYAKEIHSRVDSSLLLQSTQNVTVNARNSEGEVTGRLKVGPKMVEVQNQQFQINSNDGKPLFTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRSLSMDAPRGVHIQAHAGKIEALSQMDILFHSSDGMLVLDAETVCLPKLVQGTWGPSGSSQSLYEICVCPDGKLYLSVAGVSTTCQEHSHICL
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • SGCG MaxPab rabbit polyclonal antibody. Western Blot analysis of SGCG expression in human kidney.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SGCG expression in transfected 293T cell line (H00006445-T02) by SGCG MaxPab polyclonal antibody.

    Lane 1: SGCG transfected lysate(32.40 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of SGCG transfected lysate using anti-SGCG MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SGCG purified MaxPab mouse polyclonal antibody (B01P) (H00006445-B01P).
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6445
  • Gene Name:
  • SGCG
  • Gene Alias:
  • A4,DAGA4,DMDA,DMDA1,LGMD2C,MAM,MGC130048,SCARMD2,SCG3,TYPE
  • Gene Description:
  • sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein)
  • Gene Summary:
  • This gene encodes gamma-sarcoglycan, one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin. The dystrophin-glycoprotein complex (DGC) spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Defects in the encoded protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C). [provided by RefSeq
  • Other Designations:
  • 35kD dystrophin-associated glycoprotein,OTTHUMP00000018112,gamma sarcoglycan,sarcoglycan, gamma (35kD dystrophin-associated glycoprotein)
  • RSS
  • YouTube
  • Linkedin
  • Facebook