Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SGCA (Human) Recombinant Protein (Q01)

  • Catalog # : H00006442-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SGCA partial ORF ( NP_000014.1, 26 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • TTLHPLVGRVFVHTLDHETFLSLPEHVAVPPAVHITYHAHLQGHPDLPRWLRYTQRSPHHPGFLYGSATPEDRGLQVIEVTAYNRDSFDTTRQRLVLEIGDPEGPLLP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.62
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006442-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6442
  • Gene Name:
  • SGCA
  • Gene Alias:
  • 50-DAG,A2,ADL,DAG2,DMDA2,LGMD2D,SCARMD1,adhalin
  • Gene Description:
  • sarcoglycan, alpha (50kDa dystrophin-associated glycoprotein)
  • Gene Summary:
  • This gene encodes a component of the dystrophin-glycoprotein complex (DGC), which is critical to the stability of muscle fiber membranes and to the linking of the actin cytoskeleton to the extracellular matrix. Its expression is thought to be restricted to striated muscle. Mutations in this gene result in type 2D autosomal recessive limb-girdle muscular dystrophy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • 50kD DAG,sarcoglycan, alpha
  • RSS
  • YouTube
  • Linkedin
  • Facebook