SFTPB (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SFTPB full-length ORF ( NP_000533.2, 1 a.a. - 381 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSPTGEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
68.5
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SFTPB
Entrez GeneID
6439GeneBank Accession#
NM_000542.2Protein Accession#
NP_000533.2Gene Name
SFTPB
Gene Alias
PSP-B, SFTB3, SFTP3, SMDP1, SP-B
Gene Description
surfactant protein B
Gene Ontology
HyperlinkGene Summary
The SFTPB gene encodes the pulmonary-associated surfactant B protein (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a lipid-rich material that prevents lung collapse by lowering surface tension at the air-liquid interface in the alveoli of lung. SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Surfactant is composed of phospholipids and other surfactant-associated proteins (Clark et al., 1995 [PubMed 7644495]). See also SFTPA1 (MIM 178630), SFTPC (MIM 178620), and SFTPD (MIM 178635).[supplied by OMIM
Other Designations
Pulmonary surfactant-associated protein B, 18kD|surfactant, pulmonary-associated protein B
-
Disease
-
Publication Reference
-
Pulmonary Surfactant Protein B Carried by HDL Predicts Incident Cardiovascular Disease in Patients with Type 1 Diabetes.
Baohai Shao, Janet K Snell-Bergeon, Laura L Pyle, Katie E Thomas, Ian H de Boer, Vishal Kothari, Jere Segrest, William S Davidson, Karin E Bornfeldt, Jay W Heinecke.
Journal of Lipid Research 2022 Apr; 63(4):100196.
Application:Standard, Peptides.
-
AIBP augments cholesterol efflux from alveolar macrophages to surfactant and reduces acute lung inflammation.
Choi SH, Wallace AM, Schneider DA, Burg E, Kim J, Alekseeva E, Ubags ND, Cool CD, Fang L, Suratt BT, Miller YI.
JCI Insight 2018 Aug; 3(16):120519.
Application:Pull-Down, Mouse, MH-S cells.
-
Pulmonary Surfactant Protein B Carried by HDL Predicts Incident Cardiovascular Disease in Patients with Type 1 Diabetes.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com