SFRS10 monoclonal antibody (M01), clone 7A1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SFRS10 expression in transfected 293T cell line by SFRS10 monoclonal antibody (M01), clone 7A1.
Lane 1: SFRS10 transfected lysate(33.7 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SFRS10 is approximately 0.1ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of SFRS10 over-expressed 293 cell line, cotransfected with SFRS10 Validated Chimera RNAi ( Cat # H00006434-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SFRS10 monoclonal antibody (M01), clone 7A1 (Cat # H00006434-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (34.54 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SFRS10.
Immunogen
SFRS10 (NP_004584, 120 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRP
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.54 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SFRS10 expression in transfected 293T cell line by SFRS10 monoclonal antibody (M01), clone 7A1.
Lane 1: SFRS10 transfected lysate(33.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SFRS10 is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of SFRS10 over-expressed 293 cell line, cotransfected with SFRS10 Validated Chimera RNAi ( Cat # H00006434-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SFRS10 monoclonal antibody (M01), clone 7A1 (Cat # H00006434-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — SFRS10
Entrez GeneID
6434GeneBank Accession#
NM_004593Protein Accession#
NP_004584Gene Name
SFRS10
Gene Alias
DKFZp686F18120, Htra2-beta, SRFS10, TRA2-BETA, TRA2B, TRAN2B
Gene Description
splicing factor, arginine/serine-rich 10 (transformer 2 homolog, Drosophila)
Omim ID
602719Gene Ontology
HyperlinkGene Summary
arginine/serine-rich 10 (transformer 2 homolog
Other Designations
splicing factor, arginine/serine-rich 10|transformer 2 homolog|transformer-2-beta
-
Interactome
-
Disease
-
Publication Reference
-
Multiple therapeutic effects of valproic acid in spinal muscular atrophy model mice.
Tsai LK, Tsai MS, Ting CH, Li H.
Journal of Molecular Medicine 2008 Jul; 86(11):1243.
Application：WB, Mouse, Mouse spinal cord.
-
Multiple therapeutic effects of valproic acid in spinal muscular atrophy model mice.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com