SFRS3 monoclonal antibody (M08), clone 2D2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SFRS3.
Immunogen
SFRS3 (NP_003008, 1 a.a. ~ 85 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEK
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.09 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SFRS3 monoclonal antibody (M08), clone 2D2 Western Blot analysis of SFRS3 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
SFRS3 monoclonal antibody (M08), clone 2D2. Western Blot analysis of SFRS3 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
SFRS3 monoclonal antibody (M08), clone 2D2. Western Blot analysis of SFRS3 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
SFRS3 monoclonal antibody (M08), clone 2D2. Western Blot analysis of SFRS3 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SFRS3 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to SFRS3 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — SFRS3
Entrez GeneID
6428GeneBank Accession#
NM_003017Protein Accession#
NP_003008Gene Name
SFRS3
Gene Alias
SRp20
Gene Description
splicing factor, arginine/serine-rich 3
Omim ID
603364Gene Ontology
HyperlinkGene Summary
O
Other Designations
OTTHUMP00000016294|splicing factor, arginine/serine-rich, 20-kD
-
Interactome
-
Disease
-
Publication Reference
-
Dysregulation of alternative splicing underlies synaptic defects in familial Amyotrophic Lateral Sclerosis.
Veronica Verdile, Ramona Palombo, Gabriele Ferrante, Alberto Ferri, Susanna Amadio, Cinzia Volonté, Maria Paola Paronetto.
Progress in Neurobiology 2023 Sep; 102529.
Application:WB, Mouse, NSC-34 cells.
-
Altered expressions and splicing profiles of Acin1 transcripts differentially modulate brown adipogenesis through an alternative splicing mechanism.
Ying-Chin Lin, Yi-Han Lu, Yuan-Chii Lee, Ching-Sheng Hung, Jung-Chun Lin.
Biochimica et Biophysica Acta. Gene Regulatory Mechanisms 2020 Sep; 1863(9):194601.
Application:WB-Tr, Mouse, C3H10T1/2 cells.
-
Poison-Exon Inclusion in DHX9 Reduces Its Expression and Sensitizes Ewing Sarcoma Cells to Chemotherapeutic Treatment.
Palombo R, Verdile V, Paronetto MP.
Cells 2020 Jan; 9(2):E328.
Application:IP, WB-Tr, Human, LAP-35, SK-N-MC, TC-71 cells.
-
RBM4a-SRSF3-MAP4K4 Splicing Cascade Constitutes a Molecular Mechanism for Regulating Brown Adipogenesis.
Peng HY, Liang YC, Tan TH, Chuang HC, Lin YJ, Lin JC.
International Journal of Molecular Sciences 2018 Sep; 19(9):E2646.
Application:WB-Ti, Mouse, C3H10T1/2 cells.
-
An shRNA-Based Screen of Splicing Regulators Identifies SFRS3 as a Negative Regulator of IL-1?] Secretion.
Moura-Alves P, Neves-Costa A, Raquel H, Pacheco TR, D'Almeida B, Rodrigues R, Cadima-Couto I, Chora A, Oliveira M, Gama-Carvalho M, Hacohen N, Moita LF.
PLoS One 2011 May; 6(5):e19829.
Application:WB-Ce, WB-Tr, Human, THP-1 cells.
-
LBH589 induces up to 10-fold SMN protein levels by several independent mechanisms and is effective even in cells from SMA patients non-responsive to valproate.
Garbes L, Riessland M, Holker I, Heller R, Hauke J, Trankle C, Coras R, Blumcke I, Hahnen E, Wirth B.
Human Molecular Genetics 2009 Oct; 18(19):3645.
Application:WB-Ce, Human, Human fibroblasts.
-
Dysregulation of alternative splicing underlies synaptic defects in familial Amyotrophic Lateral Sclerosis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com