SFRS1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SFRS1 full-length ORF ( NP_008855.1, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
54.1
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SFRS1
Entrez GeneID
6426GeneBank Accession#
NM_006924.3Protein Accession#
NP_008855.1Gene Name
SFRS1
Gene Alias
ASF, MGC5228, SF2, SF2p33, SRp30a
Gene Description
splicing factor, arginine/serine-rich 1
Omim ID
600812Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the arginine/serine-rich splicing factor protein family, and functions in both constitutive and alternative pre-mRNA splicing. The protein binds to pre-mRNA transcripts and components of the spliceosome, and can either activate or repress splicing depending on the location of the pre-mRNA binding site. The protein's ability to activate splicing is regulated by phosphorylation and interactions with other splicing factor associated proteins. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
pre-mRNA-splicing factor SF2, P33 subunit|splicing factor 2
-
Interactome
-
Publication Reference
-
Combined Computational-Experimental Analyses of CFTR Exon Strength Uncover Predictability of Exon Skipping Level.
Aissat A, de Becdelievre A, Golmard L, Vasseur C, Costa C, Chaoui A, Martin N, Costes B, Goossens M, Girodon E, Fanen P, Hinzpeter A.
Human Mutation 2013 Jun; 34(6):873.
Application:GSA, Human, IB3-1 cells.
-
Combined Computational-Experimental Analyses of CFTR Exon Strength Uncover Predictability of Exon Skipping Level.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com