SFPQ monoclonal antibody (M02), clone 6D7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SFPQ.
Immunogen
SFPQ (NP_005057, 269 a.a. ~ 361 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EEKISDSEGFKANLSLLRRPGEKTYTQRCRLFVGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRALAEIAKAELDDTPMRGRQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.97 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SFPQ monoclonal antibody (M02), clone 6D7 Western Blot analysis of SFPQ expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SFPQ on formalin-fixed paraffin-embedded human thyroid nodular goiter. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SFPQ is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to SFPQ on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — SFPQ
Entrez GeneID
6421GeneBank Accession#
NM_005066Protein Accession#
NP_005057Gene Name
SFPQ
Gene Alias
POMP100, PSF
Gene Description
splicing factor proline/glutamine-rich (polypyrimidine tract binding protein associated)
Omim ID
605199Gene Ontology
HyperlinkOther Designations
OTTHUMP00000004329|PTB-associated splicing factor|polypyrimidine tract-binding protein-associated splicing factor|splicing factor proline/glutamine rich (polypyrimidine tract binding protein associated)|splicing factor proline/glutamine rich (polypyrimidi
-
Interactome
-
Publication Reference
-
Novel snail1 target proteins in human colon cancer identified by proteomic analysis.
Larriba MJ, Casado-Vela J, Pendas-Franco N, Pena R, Garcia de Herreros A, Berciano MT, Lafarga M, Casal JI, Munoz A.
PLoS One 2010 Apr; 5(4):e10221.
Application:WB, Human, SW480-ADH cells.
-
A cell-based screen for splicing regulators identifies hnRNP LL as a distinct signal-induced repressor of CD45 variable exon 4.
Topp JD, Jackson J, Melton AA, Lynch KW.
RNA 2008 Aug; 14(10):2038.
Application:WB, Human, JSL1 cells.
-
Combinatorial Control of Signal-Induced Exon Repression by HnRNP L and PSF.
Melton AA, Jackson J, Wang J, Lynch KW.
Molecular and Cellular Biology 2007 Jul; 27(19):6972.
Application:WB, Human, JSL1 cells.
-
Novel snail1 target proteins in human colon cancer identified by proteomic analysis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com