Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SELL (Human) Recombinant ProteinProteoliposome

  • Catalog # : H00006402-G01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SELL full-length ORF (NP_000646.1) recombinant protein without tag.
  • Sequence:
  • MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 42.2
  • Form:
  • Liquid
  • Recommend Usage:
  • Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
  • Storage Buffer:
  • 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Antibody Production
  • Functional Study
  • Recommended usage only, not validated yet.
  • Compound Screening
  • Recommended usage only, not validated yet.
  • Application Image
  • Antibody Production
  • Functional Study
  • Compound Screening
  • Gene Information
  • Entrez GeneID:
  • 6402
  • Gene Name:
  • SELL
  • Gene Alias:
  • CD62L,LAM-1,LAM1,LECAM1,LNHR,LSEL,LYAM1,Leu-8,Lyam-1,PLNHR,TQ1,hLHRc
  • Gene Description:
  • selectin L
  • Gene Summary:
  • SELL is a cell surface component that is a member of a family of adhesion/homing receptors which play important roles in leukocyte-endothelial cell interactions. The molecule is composed of multiple domains: one homologous to lectins, one to epidermal growth factor, and two to the consensus repeat units found in C3/C4 binding proteins. [provided by RefSeq
  • Other Designations:
  • Leu-8 antigen,leukocyte adhesion molecule-1,lymph node homing receptor,lymphocyte adhesion molecule 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook