Product Browser

Last updated: 2017/2/19
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SEC13 monoclonal antibody (M02), clone 1G7

  • Catalog # : H00006396-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant SEC13.
  • Immunogen:
  • SEC13 (NP_109598, 226 a.a. ~ 324 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • SIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of SEC13 transfected lysate using anti-SEC13 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SEC13 MaxPab rabbit polyclonal antibody.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged SEC13 is 0.03 ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6396
  • Gene Name:
  • SEC13
  • Gene Alias:
  • D3S1231E,SEC13L1,SEC13R,npp-20
  • Gene Description:
  • SEC13 homolog (S. cerevisiae)
  • Gene Summary:
  • The protein encoded by this gene belongs to the SEC13 family of WD-repeat proteins. It is a constituent of the endoplasmic reticulum and the nuclear pore complex. It has similarity to the yeast SEC13 protein, which is required for vesicle biogenesis from endoplasmic reticulum during the transport of proteins. Multiple alternatively spliced transcript variants have been found. [provided by RefSeq
  • Other Designations:
  • SEC13 protein,SEC13-like 1 isoform,SEC13-related protein
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook