Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SDHC (Human) Recombinant Protein (P01)

  • Catalog # : H00006391-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SDHC full-length ORF ( AAH33626, 1 a.a. - 169 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNRPLSPHITIYSWSLPMAMSICHRGTGIALSAGVSLFGMSALLLPGNFESYLELVKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLKIPQLYQSGVVVLVLTVLSSMGLAAM
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 44.33
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006391-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6391
  • Gene Name:
  • SDHC
  • Gene Alias:
  • CYB560,CYBL,PGL3,QPS1,SDH3
  • Gene Description:
  • succinate dehydrogenase complex, subunit C, integral membrane protein, 15kDa
  • Gene Summary:
  • This gene encodes one of four nuclear-encoded subunits that comprise succinate dehydrogenase, also known as mitochondrial complex II, a key enzyme complex of the tricarboxylic acid cycle and aerobic respiratory chains of mitochondria. The encoded protein is one of two integral membrane proteins that anchor other subunits of the complex, which form the catalytic core, to the inner mitochondrial membrane. Several related pseudogenes are located in different genomic regions. Mutations in this gene have been associated with paragangliomas. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000032375,cytochrome B large subunit of complex II,integral membrane protein CII-3,integral membrane protein CII-3b,succinate dehydrogenase complex, subunit C,succinate dehydrogenase cytochrome b560 subunit,succinate-ubiquinone oxidoreducatase cy
  • RSS
  • YouTube
  • Linkedin
  • Facebook