SDF2 monoclonal antibody (M01), clone 3G7-1D6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SDF2 monoclonal antibody (M01), clone 3G7-1D6 Western Blot analysis of SDF2 expression in WI-38 ( Cat # L016V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SDF2 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SDF2 is 1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (46.75 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant SDF2.
Immunogen
SDF2 (AAH00500.1, 20 a.a. ~ 211 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SLGVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLKAEAHHAEL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (95)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (46.75 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SDF2 monoclonal antibody (M01), clone 3G7-1D6 Western Blot analysis of SDF2 expression in WI-38 ( Cat # L016V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SDF2 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SDF2 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — SDF2
Entrez GeneID
6388GeneBank Accession#
BC000500Protein Accession#
AAH00500.1Gene Name
SDF2
Gene Alias
-
Gene Description
stromal cell-derived factor 2
Omim ID
602934Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com