Product Browser

Last updated: 2017/12/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CXCL12 (Human) Recombinant Protein (P01)

  • Catalog # : H00006387-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CXCL12 full-length ORF ( AAH39893.1, 1 a.a. - 89 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.53
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006387-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6387
  • Gene Name:
  • CXCL12
  • Gene Alias:
  • PBSF,SCYB12,SDF-1a,SDF-1b,SDF1,SDF1A,SDF1B,TLSF-a,TLSF-b,TPAR1
  • Gene Description:
  • chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1)
  • Gene Summary:
  • For background information on chemokines, see CXCL1 (MIM 155730). Stromal cell-derived factors 1-alpha and 1-beta are small cytokines that belong to the intercrine family, members of which activate leukocytes and are often induced by proinflammatory stimuli such as lipopolysaccharide, TNF (see MIM 191160), or IL1 (see MIM 147760). The intercrines are characterized by the presence of 4 conserved cysteines which form 2 disulfide bonds. They can be classified into 2 subfamilies. In the CC subfamily, which includes beta chemokine, the cysteine residues are adjacent to each other. In the CXC subfamily, which includes alpha chemokine, they are separated by an intervening amino acid. The SDF1 proteins belong to the latter group.[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000019491,stromal cell-derived factor 1 delta,stromal cell-derived factor 1 gamma,stromal cell-derived factor 1a
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook