SDCBP monoclonal antibody (M01), clone 2C12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SDCBP monoclonal antibody (M01), clone 2C12 Western Blot analysis of SDCBP expression in HepG2 ( Cat # L019V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of SDCBP expression in transfected 293T cell line by SDCBP monoclonal antibody (M01), clone 2C12.
Lane 1: SDCBP transfected lysate(32.4 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SDCBP on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
Immunoprecipitation
Immunoprecipitation of SDCBP transfected lysate using anti-SDCBP monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SDCBP MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SDCBP is approximately 0.03ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to SDCBP on HepG2 cell. [antibody concentration 35 ug/ml]
Immunofluorescence
Immunofluorescence of monoclonal antibody to SDCBP on HeLa cell . [antibody concentration 35 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SDCBP.
Immunogen
SDCBP (NP_005616, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGND
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SDCBP monoclonal antibody (M01), clone 2C12 Western Blot analysis of SDCBP expression in HepG2 ( Cat # L019V1 ).Western Blot (Transfected lysate)
Western Blot analysis of SDCBP expression in transfected 293T cell line by SDCBP monoclonal antibody (M01), clone 2C12.
Lane 1: SDCBP transfected lysate(32.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SDCBP on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of SDCBP transfected lysate using anti-SDCBP monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SDCBP MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SDCBP is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to SDCBP on HepG2 cell. [antibody concentration 35 ug/ml]Immunofluorescence
Immunofluorescence of monoclonal antibody to SDCBP on HeLa cell . [antibody concentration 35 ug/ml] -
Gene Info — SDCBP
Entrez GeneID
6386GeneBank Accession#
NM_005625Protein Accession#
NP_005616Gene Name
SDCBP
Gene Alias
MDA-9, ST1, SYCL, TACIP18
Gene Description
syndecan binding protein (syntenin)
Omim ID
602217Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
melanoma differentiation associated protein-9|pro-TGF-alpha cytoplasmic domain-interacting protein 18|scaffold protein Pbp1|syntenin
-
Interactome
-
Publication Reference
-
PDZ proteins SCRIB and DLG1 regulate myeloma cell surface CD86 expression, growth, and survival.
Tyler Moser-Katz, Catherine M Gavile, Benjamin G Barwick, Kelvin P Lee, Lawrence H Boise.
Molecular Cancer Research : MCR 2022 Jul; 20(7):1122.
Application：PLA-Ce, Human, MM.1s, RPMI 8226 cells.
-
Oncogene-regulated release of extracellular vesicles.
Seda Kilinc, Rebekka Paisner, Roman Camarda, Suprit Gupta, Olga Momcilovic, Rebecca A Kohnz, Baris Avsaroglu, Noelle D L'Etoile, Rushika M Perera, Daniel K Nomura, Andrei Goga.
Developmental Cell 2021 Jul; 56(13):1989.
Application：WB-Ce, Human, MCF10A cells.
-
Pharmacological inhibition of MDA-9/Syntenin blocks breast cancer metastasis through suppression of IL-1β.
Anjan K Pradhan, Santanu Maji, Praveen Bhoopathi, Sarmistha Talukdar, Padmanabhan Mannangatti, Chunqing Guo, Xiang-Yang Wang, Lorraine Colon Cartagena, Michael Idowu, Joseph W Landry, Devanand Sarkar, Luni Emdad, Webster K Cavenee, Swadesh K Das, Paul B Fisher.
PNAS 2021 May; 118(21):e210318011.
Application：WB-Tr, Human, T-47D cells.
-
Regulation of neuroblastoma migration, invasion, and in vivo metastasis by genetic and pharmacological manipulation of MDA-9/Syntenin.
Bhoopathi P, Pradhan AK, Bacolod MD, Emdad L, Sarkar D, Das SK, Fisher PB.
Oncogene 2019 Oct; 38(41):6781.
Application：IHC, Wb-Ce, WB-Tr, Human, IM-PHFA, SK-N-AS, NB1691, SK-N-SH cells, Neuroblastoma.
-
Syntenin1/MDA-9 (SDCBP) induces immune evasion in triple-negative breast cancer by upregulating PD-L1.
Liu J, Yang Y, Wang H, Wang B, Zhao K, Jiang W, Bai W, Liu J, Yin J.
Breast Cancer Research and Treatment 2018 Sep; 171(2):345.
Application：IHC, WB-Tr, Human, Triple-negative breast cancer, MDA-MB-231, MDA-MB-231-syntenin1, MDA-MB-231-scramble, MDA-MB-231-syntenin1-KD, CAL-51, CAL-5-syntenin1, CAL-5-scramble, CAL-5-syntenin1-KD cells.
-
Genetic Mutation and Exosome Signature of Human Papilloma Virus Associated Oropharyngeal Cancer.
Kannan A, Hertweck KL, Philley JV, Wells RB, Dasgupta S.
Amino Acids 2017 Apr; 7:46102.
Application：WB, Human, UM-SCC-104 cells.
-
NF-κB Is a Potential Molecular Drug Target in Triple-Negative Breast Cancers.
Poma P, Labbozzetta M, D'Alessandro N, Notarbartolo M.
Amino Acids 2017 Apr; 21(4):225.
Application：WB-Tr, Human, MDA-MB-231, SUM 149, SUM 159 cells.
-
MDA-9/Syntenin regulates differentiation and angiogenesis programs in head and neck squamous cell carcinoma.
Oyesanya RA, Bhatia S, Menezes ME, Dumur CI, Singh KP, Bae S, Troyer DA, Wells RB, Sauter ER, Sidransky D, Fisher PB, Semmes OJ, Dasgupta S.
Oncoscience 2014 Sep; 1(11):725.
Application：IF, IHC-P, IP-WB, WB-Ti, Human, Human head and neck squamous cell carcinoma, and FaDU, HEK 293, HN41, OKF6 cells.
-
Syntenin increases the invasiveness of small cell lung cancer cells by activating p38, AKT, focal adhesion kinase and SP1.
Wook Youn Kim, Ji-young Jang, Yoon Kyung Jeon, Doo Hyun Chung, Young Goo Kim, Chul-Woo Kim.
Experimental & Molecular Medicine 2014 Apr; 46(4):e90.
Application：IHC-P, WB-Ce, WB-Tr, Human, Human neuroblastomas, NCI-H69, NCI-H146, NCI-H187, NCI-H209, NCI-H417, NCI-H889 cells.
-
Novel Role of MDA-9/Syntenin in Regulating Urothelial Cell Proliferation by Modulating EGFR Signaling.
Santanu Dasgupta, Mitchell E Menezes, Swadesh K Das, Luni Emdad, Aleksandar Janjic, Shilpa Bhatia, Nitai D Mukhopadhyay, Chunbo Shao, Devanand Sarkar, Paul B Fisher.
Clinical Cancer Research 2013 Sep; 19(17):4621.
Application：IF, IHC-P, IP, WB-Ti, WB-Tr, Human, Human urothelial cell carcinoma, HUC-1 cells, T24 cells, SCaBER cells, SW780 cells.
-
MDA-9/Syntenin and IGFBP-2 Promote Angiogenesis in Human Melanoma.
Das SK, Bhutia SK, Azab B, Kegelman TP, Peachy L, Santhekadur PK, Dasgupta S, Dash R, Dent P, Grant S, Emdad L, Pellecchia M, Sarkar D, Fisher PB.
Cancer Research 2012 Dec; 73(2):844.
Application：WB, IHC-P, Human, Mouse, Mouse tumors, Human FM-516.
-
Raf kinase inhibitor RKIP inhibits MDA-9/syntenin-mediated metastasis in melanoma.
Swadesh K Das, Sujit K Bhutia, Upneet K Sokhi, Belal Azab, Zhao-Zhong Su, Habib Boukerche, Talha Anwar, Erika L Moen, Devasis Chatterjee, Maurizio Pellecchia, Devanand Sarkar, Paul B Fisher.
Cancer Research 2012 Dec; 72(23):6217.
Application：IF, WB-Ce, WB-Tr, Human, C8161.9, FM-516, FO-1, MeWo, WM35, WM278 cells.
-
Systematic proteomic analysis of human hepotacellular carcinoma cells reveals molecular pathways and networks involved in metastasis.
Yu Y, Shen H, Yu H, Zhong F, Zhang Y, Zhang C, Zhao J, Li H, Chen J, Liu Y, Yang P.
Molecular BioSystems 2011 Jun; 7(6):1908.
Application：WB-Ce, Human, MHCC97L, MHCC97H, HCCLM3, HCCLM6.
-
PDZ proteins SCRIB and DLG1 regulate myeloma cell surface CD86 expression, growth, and survival.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com