SDCBP purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
SDCBP MaxPab polyclonal antibody. Western Blot analysis of SDCBP expression in human pancreas.
Western Blot (Cell lysate)
SDCBP MaxPab polyclonal antibody. Western Blot analysis of SDCBP expression in A-549.
Western Blot (Transfected lysate)
Western Blot analysis of SDCBP expression in transfected 293T cell line (H00006386-T01) by SDCBP MaxPab polyclonal antibody.
Lane 1: SDCBP transfected lysate(32.78 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to SDCBP on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human SDCBP protein.
Immunogen
SDCBP (NP_001007068.1, 1 a.a. ~ 298 a.a) full-length human protein.
Sequence
MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SDCBP MaxPab polyclonal antibody. Western Blot analysis of SDCBP expression in human pancreas.Western Blot (Cell lysate)
SDCBP MaxPab polyclonal antibody. Western Blot analysis of SDCBP expression in A-549.Western Blot (Transfected lysate)
Western Blot analysis of SDCBP expression in transfected 293T cell line (H00006386-T01) by SDCBP MaxPab polyclonal antibody.
Lane 1: SDCBP transfected lysate(32.78 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to SDCBP on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — SDCBP
Entrez GeneID
6386GeneBank Accession#
NM_001007067Protein Accession#
NP_001007068.1Gene Name
SDCBP
Gene Alias
MDA-9, ST1, SYCL, TACIP18
Gene Description
syndecan binding protein (syntenin)
Omim ID
602217Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
melanoma differentiation associated protein-9|pro-TGF-alpha cytoplasmic domain-interacting protein 18|scaffold protein Pbp1|syntenin
-
Interactome
-
Publication Reference
-
Differential protein profiling of renal cell carcinoma urinary exosomes.
Raimondo F, Morosi L, Corbetta S, Chinello C, Brambilla P, Della Mina P, Villa A, Albo G, Battaglia C, Bosari S, Magni F, Pitto M.
Molecular BioSystems 2013 Jun; 9(6):1220.
Application：WB, Human, Human urine samples.
-
Differential protein profiling of renal cell carcinoma urinary exosomes.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com