SDC2 purified MaxPab mouse polyclonal antibody (B04P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SDC2 expression in transfected 293T cell line (H00006383-T06) by SDC2 MaxPab polyclonal antibody.
Lane 1: SDC2 transfected lysate(20.13 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human SDC2 protein.
Immunogen
SDC2 (NP_002989.2, 19 a.a. ~ 201 a.a) full-length human protein.
Sequence
ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTTRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKPSSAAYQKAPTKEFYA
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SDC2 expression in transfected 293T cell line (H00006383-T06) by SDC2 MaxPab polyclonal antibody.
Lane 1: SDC2 transfected lysate(20.13 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — SDC2
Entrez GeneID
6383GeneBank Accession#
NM_002998Protein Accession#
NP_002989.2Gene Name
SDC2
Gene Alias
HSPG, HSPG1, SYND2
Gene Description
syndecan 2
Omim ID
142460Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. The syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are required for internalization of the HIV-1 tat protein. The syndecan-2 protein functions as an integral membrane protein and participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. Altered syndecan-2 expression has been detected in several different tumor types. [provided by RefSeq
Other Designations
cell surface-associated heparan sulfate proteoglycan 1|fibroglycan|heparan sulfate proteoglycan 1, cell surface-associated|heparan sulfate proteoglycan core protein|syndecan proteoglycan 2
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Cell surface heparan sulfate proteoglycans control adhesion and invasion of breast carcinoma cells.
Lim H, Multhaupt H, Couchman JR.
Molecular Cancer 2015 Jan; 14(1):15.
Application：Flow Cyt, WB-Ce, Human, MDA-MB231 cells.
-
Syndecan-2 regulation of morphology in breast carcinoma cells is dependent on RhoGTPases.
Lim HC, Couchman JR.
Biochimica et Biophysica Acta 2014 Aug; 1840(8):2482.
Application：Flow Cyt, Human, MDA-MB231 cells.
-
Cell surface heparan sulfate proteoglycans control adhesion and invasion of breast carcinoma cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com