Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SDC2 purified MaxPab mouse polyclonal antibody (B04P)MaxPab

  • Catalog # : H00006383-B04P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human SDC2 protein.
  • Immunogen:
  • SDC2 (NP_002989.2, 19 a.a. ~ 201 a.a) full-length human protein.
  • Sequence:
  • ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTTRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKPSSAAYQKAPTKEFYA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SDC2 expression in transfected 293T cell line (H00006383-T06) by SDC2 MaxPab polyclonal antibody.

    Lane 1: SDC2 transfected lysate(20.13 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6383
  • Gene Name:
  • SDC2
  • Gene Alias:
  • HSPG,HSPG1,SYND2
  • Gene Description:
  • syndecan 2
  • Gene Summary:
  • The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. The syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are required for internalization of the HIV-1 tat protein. The syndecan-2 protein functions as an integral membrane protein and participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. Altered syndecan-2 expression has been detected in several different tumor types. [provided by RefSeq
  • Other Designations:
  • cell surface-associated heparan sulfate proteoglycan 1,fibroglycan,heparan sulfate proteoglycan 1, cell surface-associated,heparan sulfate proteoglycan core protein,syndecan proteoglycan 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook