Product Browser

Last updated: 2017/7/16

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CXCL5 (Human) Recombinant Protein (P01)

  • Catalog # : H00006374-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CXCL5 full-length ORF ( AAH08376, 1 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLRKVIQKILDGGNKEN
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 38.28
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006374-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6374
  • Gene Name:
  • CXCL5
  • Gene Alias:
  • ENA-78,SCYB5
  • Gene Description:
  • chemokine (C-X-C motif) ligand 5
  • Gene Summary:
  • The protein encoded by this gene is an inflammatory chemokine that belongs to the CXC chemokine family. This chemokine is produced concomitantly with interleukin-8 (IL8) in response to stimulation with either interleukin-1 (IL1) or tumor necrosis factor-alpha (TNFA). This chemokine is a potent chemotaxin involved in neutrophil activation. [provided by RefSeq
  • Other Designations:
  • epithelial-derived neutrophil activating protein 78,epithelial-derived neutrophil-activating peptide 78,neutrophil-activating peptide ENA-78,neutrophil-activating protein 78,small inducible cytokine B5,small inducible cytokine subfamily B (Cys-X-Cys), mem
  • RSS
  • YouTube
  • Linkedin
  • Facebook