CXCL11 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CXCL11 protein.
Immunogen
CXCL11 (NP_005400.1, 1 a.a. ~ 94 a.a) full-length human protein.
Sequence
MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Rat (64)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CXCL11 MaxPab rabbit polyclonal antibody. Western Blot analysis of CXCL11 expression in Jurkat.Western Blot (Cell lysate)
CXCL11 MaxPab rabbit polyclonal antibody. Western Blot analysis of CXCL11 expression in NIH/3T3.Western Blot (Transfected lysate)
Western Blot analysis of CXCL11 expression in transfected 293T cell line (H00006373-T02) by CXCL11 MaxPab polyclonal antibody.
Lane 1: CXCL11 transfected lysate(10.40 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CXCL11
Entrez GeneID
6373GeneBank Accession#
NM_005409Protein Accession#
NP_005400.1Gene Name
CXCL11
Gene Alias
H174, I-TAC, IP-9, IP9, MGC102770, SCYB11, SCYB9B, b-R1
Gene Description
chemokine (C-X-C motif) ligand 11
Omim ID
604852Gene Ontology
HyperlinkGene Summary
Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC. This gene is a CXC member of the chemokine superfamily. Its encoded protein induces a chemotactic response in activated T-cells and is the dominant ligand for CXC receptor-3. The gene encoding this protein contains 4 exons and at least three polyadenylation signals which might reflect cell-specific regulation of expression. IFN-gamma is a potent inducer of transcription of this gene. [provided by RefSeq
Other Designations
small inducible cytokine B11|small inducible cytokine subfamily B (Cys-X-Cys), member 11|small inducible cytokine subfamily B (Cys-X-Cys), member 9B
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com