Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL25 (Human) Recombinant Protein (Q01)

  • Catalog # : H00006370-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CCL25 partial ORF ( NP_005615, 24 a.a. - 113 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHA
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.64
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006370-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6370
  • Gene Name:
  • CCL25
  • Gene Alias:
  • Ckb15,MGC150327,SCYA25,TECK
  • Gene Description:
  • chemokine (C-C motif) ligand 25
  • Gene Summary:
  • This gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for dendritic cells, thymocytes, and activated macrophages but is inactive on peripheral blood lymphocytes and neutrophils. The product of this gene binds to chemokine receptor CCR9. [provided by RefSeq
  • Other Designations:
  • Ck beta-15,TECKvar,chemokine TECK,small inducible cytokine A25,small inducible cytokine subfamily A (Cys-Cys), member 25,thymus expressed chemokine
  • RSS
  • YouTube
  • Linkedin
  • Facebook