Product Browser

Last updated: 2017/8/13

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL25 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00006370-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human CCL25 protein.
  • Immunogen:
  • CCL25 (ADR82824.1, 1 a.a. ~ 150 a.a) full-length human protein.
  • Sequence:
  • MNLWLLACLVAGFLGAWAPAVHTQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Application Image
  • Western Blot (Transfected lysate)
  • Gene Information
  • Entrez GeneID:
  • 6370
  • Gene Name:
  • CCL25
  • Gene Alias:
  • Ckb15,MGC150327,SCYA25,TECK
  • Gene Description:
  • chemokine (C-C motif) ligand 25
  • Gene Summary:
  • This gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for dendritic cells, thymocytes, and activated macrophages but is inactive on peripheral blood lymphocytes and neutrophils. The product of this gene binds to chemokine receptor CCR9. [provided by RefSeq
  • Other Designations:
  • Ck beta-15,TECKvar,chemokine TECK,small inducible cytokine A25,small inducible cytokine subfamily A (Cys-Cys), member 25,thymus expressed chemokine
  • RSS
  • YouTube
  • Linkedin
  • Facebook