Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL24 (Human) Recombinant Protein (P01)

  • Catalog # : H00006369-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CCL24 full-length ORF ( NP_002982.2, 1 a.a. - 119 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 39.5
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006369-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6369
  • Gene Name:
  • CCL24
  • Gene Alias:
  • Ckb-6,MPIF-2,MPIF2,SCYA24
  • Gene Description:
  • chemokine (C-C motif) ligand 24
  • Gene Summary:
  • This gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity on resting T lymphocytes, a minimal activity on neutrophils, and is negative on monocytes and activated T lymphocytes. The protein is also a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. [provided by RefSeq
  • Other Designations:
  • CK-beta-6,eotaxin-2,myeloid progenitor inhibitory factor 2,small inducible cytokine A24,small inducible cytokine subfamily A (Cys-Cys), member 24
  • RSS
  • YouTube
  • Linkedin
  • Facebook