CCL21 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CCL21 full-length ORF ( NP_002980.1, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
41
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CCL21
Entrez GeneID
6366GeneBank Accession#
NM_002989.2Protein Accession#
NP_002980.1Gene Name
CCL21
Gene Alias
6Ckine, CKb9, ECL, MGC34555, SCYA21, SLC, TCA4
Gene Description
chemokine (C-C motif) ligand 21
Omim ID
602737Gene Ontology
HyperlinkGene Summary
This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. Similar to other chemokines the protein encoded by this gene inhibits hemopoiesis and stimulates chemotaxis. This protein is chemotactic in vitro for thymocytes and activated T cells, but not for B cells, macrophages, or neutrophils. The cytokine encoded by this gene may also play a role in mediating homing of lymphocytes to secondary lymphoid organs. It is a high affinity functional ligand for chemokine receptor 7 (CCR7) that is expressed on T and B lymphocytes and a known receptor for another member of the cytokine family (small inducible cytokine A19). [provided by RefSeq
Other Designations
Efficient Chemoattractant for Lymphocytes|OTTHUMP00000000526|OTTHUMP00000000527|OTTHUMP00000021304|beta chemokine exodus-2|exodus-2|secondary lymphoid tissue chemokine|small inducible cytokine A21|small inducible cytokine subfamily A (Cys-Cys), member 21
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com