CCL21 MaxPab mouse polyclonal antibody (B01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CCL21 protein.
Immunogen
CCL21 (NP_002980, 1 a.a. ~ 134 a.a) full-length human protein.
Sequence
MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CCL21 expression in transfected 293T cell line (H00006366-T01) by CCL21 MaxPab polyclonal antibody.
Lane 1: CCL21 transfected lysate(14.74 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CCL21
Entrez GeneID
6366GeneBank Accession#
NM_002989Protein Accession#
NP_002980Gene Name
CCL21
Gene Alias
6Ckine, CKb9, ECL, MGC34555, SCYA21, SLC, TCA4
Gene Description
chemokine (C-C motif) ligand 21
Omim ID
602737Gene Ontology
HyperlinkGene Summary
This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. Similar to other chemokines the protein encoded by this gene inhibits hemopoiesis and stimulates chemotaxis. This protein is chemotactic in vitro for thymocytes and activated T cells, but not for B cells, macrophages, or neutrophils. The cytokine encoded by this gene may also play a role in mediating homing of lymphocytes to secondary lymphoid organs. It is a high affinity functional ligand for chemokine receptor 7 (CCR7) that is expressed on T and B lymphocytes and a known receptor for another member of the cytokine family (small inducible cytokine A19). [provided by RefSeq
Other Designations
Efficient Chemoattractant for Lymphocytes|OTTHUMP00000000526|OTTHUMP00000000527|OTTHUMP00000021304|beta chemokine exodus-2|exodus-2|secondary lymphoid tissue chemokine|small inducible cytokine A21|small inducible cytokine subfamily A (Cys-Cys), member 21
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com