CCL19 (Human) Recombinant Protein (P02)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CCL19 full-length ORF ( NP_006265.1, 1 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.4
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CCL19
Entrez GeneID
6363GeneBank Accession#
NM_006274.2Protein Accession#
NP_006265.1Gene Name
CCL19
Gene Alias
CKb11, ELC, MGC34433, MIP-3b, MIP3B, SCYA19
Gene Description
chemokine (C-C motif) ligand 19
Omim ID
602227Gene Ontology
HyperlinkGene Summary
This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene may play a role in normal lymphocyte recirculation and homing. It also plays an important role in trafficking of T cells in thymus, and in T cell and B cell migration to secondary lymphoid organs. It specifically binds to chemokine receptor CCR7. [provided by RefSeq
Other Designations
CC chemokine ligand 19|CK beta-11|EBI1-ligand chemokine|OTTHUMP00000000531|OTTHUMP00000021295|beta chemokine exodus-3|exodus-3|macrophage inflammatory protein 3-beta|small inducible cytokine A19|small inducible cytokine subfamily A (Cys-Cys), member 19
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com