Product Browser

Last updated: 2017/8/20
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL19 monoclonal antibody (M03A), clone 3E9

  • Catalog # : H00006363-M03A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant CCL19.
  • Immunogen:
  • CCL19 (AAH27968, 1 a.a. ~ 98 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgM Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6363
  • Gene Name:
  • CCL19
  • Gene Alias:
  • CKb11,ELC,MGC34433,MIP-3b,MIP3B,SCYA19
  • Gene Description:
  • chemokine (C-C motif) ligand 19
  • Gene Summary:
  • This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene may play a role in normal lymphocyte recirculation and homing. It also plays an important role in trafficking of T cells in thymus, and in T cell and B cell migration to secondary lymphoid organs. It specifically binds to chemokine receptor CCR7. [provided by RefSeq
  • Other Designations:
  • CC chemokine ligand 19,CK beta-11,EBI1-ligand chemokine,OTTHUMP00000000531,OTTHUMP00000021295,beta chemokine exodus-3,exodus-3,macrophage inflammatory protein 3-beta,small inducible cytokine A19,small inducible cytokine subfamily A (Cys-Cys), member 19
  • RSS
  • YouTube
  • Linkedin
  • Facebook