Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL18 (Human) Recombinant Protein (Q01)

  • Catalog # : H00006362-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CCL18 partial ORF ( NP_002979, 21 a.a. - 89 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 33.33
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006362-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6362
  • Gene Name:
  • CCL18
  • Gene Alias:
  • AMAC-1,AMAC1,CKb7,DC-CK1,DCCK1,MIP-4,PARC,SCYA18
  • Gene Description:
  • chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated)
  • Gene Summary:
  • This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for naive T cells, CD4+ and CD8+ T cells and nonactivated lymphocytes, but not for monocytes or granulocytes. This chemokine attracts naive T lymphocytes toward dendritic cells and activated macrophages in lymph nodes. It may play a role in both humoral and cell-mediated immunity responses. [provided by RefSeq
  • Other Designations:
  • CC chemokine ligand 18,alternative macrophage activation-associated CC chemokine 1,chemokine (C-C), dendritic,dendritic cell chemokine 1,macrophage inflammatory protein 4,pulmonary and activation-regulated chemokine,small inducible cytokine A18,small indu
  • RSS
  • YouTube
  • Linkedin
  • Facebook