CCL17 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CCL17 partial ORF ( NP_002978, 24 a.a. - 94 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
33.55
Interspecies Antigen Sequence
Mouse (67); Rat (67)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CCL17
Entrez GeneID
6361GeneBank Accession#
NM_002987Protein Accession#
NP_002978Gene Name
CCL17
Gene Alias
A-152E5.3, ABCD-2, MGC138271, MGC138273, SCYA17, TARC
Gene Description
chemokine (C-C motif) ligand 17
Omim ID
601520Gene Ontology
HyperlinkGene Summary
This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for T lymphocytes, but not monocytes or granulocytes. The product of this gene binds to chemokine receptors CCR4 and CCR8. This chemokine plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells. [provided by RefSeq
Other Designations
OTTHUMP00000164673|T cell-directed CC chemokine|small inducible cytokine A17|small inducible cytokine subfamily A (Cys-Cys), member 17|thymus and activation-regulated chemokine
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com