Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL17 monoclonal antibody (M07A), clone 2E7

  • Catalog # : H00006361-M07A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant CCL17.
  • Immunogen:
  • CCL17 (NP_002978.1, 24 a.a. ~ 94 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006361-M07A
    Western Blot detection against Immunogen (7.8 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6361
  • Gene Name:
  • CCL17
  • Gene Alias:
  • A-152E5.3,ABCD-2,MGC138271,MGC138273,SCYA17,TARC
  • Gene Description:
  • chemokine (C-C motif) ligand 17
  • Gene Summary:
  • This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for T lymphocytes, but not monocytes or granulocytes. The product of this gene binds to chemokine receptors CCR4 and CCR8. This chemokine plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000164673,T cell-directed CC chemokine,small inducible cytokine A17,small inducible cytokine subfamily A (Cys-Cys), member 17,thymus and activation-regulated chemokine
  • RSS
  • YouTube
  • Linkedin
  • Facebook