Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Pathway

  • By Biomarker

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL15 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00006359-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human CCL15 protein.
  • Immunogen:
  • CCL15 (NP_004158.2, 1 a.a. ~ 113 a.a) full-length human protein.
  • Sequence:
  • MKVSVAALSCLMLVAVLGSQAQFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CCL15 expression in transfected 293T cell line (H00006359-T02) by CCL15 MaxPab polyclonal antibody.

    Lane 1: CCL15 transfected lysate(12.20 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of CCL15 transfected lysate using anti-CCL15 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CCL15 MaxPab rabbit polyclonal antibody (D01) (H00006359-D01).
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6359
  • Gene Name:
  • CCL15
  • Gene Alias:
  • HCC-2,HMRP-2B,LKN1,Lkn-1,MIP-1d,MIP-5,NCC-3,NCC3,SCYA15,SCYL3,SY15
  • Gene Description:
  • chemokine (C-C motif) ligand 15
  • Gene Summary:
  • This gene, CCL15, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene is chemotactic for T cells and monocytes and induces N-acetyl-beta-D-glucosaminidase release in monocytes. It induces changes in intracellular calcium concentration in monocytes and is thought to act through the CCR1 receptor. Read-through transcripts are expressed that include exons from the downstream cytokine gene CCL14, and are represented as GeneID: 348249. [provided by RefSeq
  • Other Designations:
  • CC chemokine 3,MIP-1 delta,OTTHUMP00000163955,chemokine CC-2,leukotactin 1,macrophage inflammatory protein 5,small inducible cytokine subfamily A (Cys-Cys), member 15
  • RSS
  • YouTube
  • Linkedin
  • Facebook