Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Pathway

  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL15 polyclonal antibody (A01)

  • Catalog # : H00006359-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CCL15.
  • Immunogen:
  • CCL15 (NP_116741, 25 a.a. ~ 113 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • NDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006359-A01
    Western Blot detection against Immunogen (35.79 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6359
  • Gene Name:
  • CCL15
  • Gene Alias:
  • HCC-2,HMRP-2B,LKN1,Lkn-1,MIP-1d,MIP-5,NCC-3,NCC3,SCYA15,SCYL3,SY15
  • Gene Description:
  • chemokine (C-C motif) ligand 15
  • Gene Summary:
  • This gene, CCL15, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene is chemotactic for T cells and monocytes and induces N-acetyl-beta-D-glucosaminidase release in monocytes. It induces changes in intracellular calcium concentration in monocytes and is thought to act through the CCR1 receptor. Read-through transcripts are expressed that include exons from the downstream cytokine gene CCL14, and are represented as GeneID: 348249. [provided by RefSeq
  • Other Designations:
  • CC chemokine 3,MIP-1 delta,OTTHUMP00000163955,chemokine CC-2,leukotactin 1,macrophage inflammatory protein 5,small inducible cytokine subfamily A (Cys-Cys), member 15
  • RSS
  • YouTube
  • Linkedin
  • Facebook