Product Browser

Last updated: 2017/8/13

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL14 (Human) Recombinant Protein (P01)

  • Catalog # : H00006358-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CCL14 full-length ORF ( AAH45165, 20 a.a. - 93 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 33.88
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006358-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6358
  • Gene Name:
  • CCL14
  • Gene Alias:
  • CC-1,CC-3,CKb1,HCC-1,HCC-3,MCIF,NCC-2,NCC2,SCYA14,SCYL2,SY14
  • Gene Description:
  • chemokine (C-C motif) ligand 14
  • Gene Summary:
  • This gene, CCL14, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene induces changes in intracellular calcium concentration and enzyme release in monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Read-through transcripts are also expressed that include exons from the upstream cytokine gene CCL15, and are represented as GeneID: 348249. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000176860,chemokine CC-1,chemokine CC-3,small inducible cytokine subfamily A (Cys-Cys), member 14
  • RSS
  • YouTube
  • Linkedin
  • Facebook