Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL14 monoclonal antibody (M04), clone 3B12

  • Catalog # : H00006358-M04
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full length recombinant CCL14.
  • Immunogen:
  • CCL14 (AAH45165, 20 a.a. ~ 93 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006358-M04
    Western Blot detection against Immunogen (33.88 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6358
  • Gene Name:
  • CCL14
  • Gene Alias:
  • CC-1,CC-3,CKb1,HCC-1,HCC-3,MCIF,NCC-2,NCC2,SCYA14,SCYL2,SY14
  • Gene Description:
  • chemokine (C-C motif) ligand 14
  • Gene Summary:
  • This gene, CCL14, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene induces changes in intracellular calcium concentration and enzyme release in monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Read-through transcripts are also expressed that include exons from the upstream cytokine gene CCL15, and are represented as GeneID: 348249. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000176860,chemokine CC-1,chemokine CC-3,small inducible cytokine subfamily A (Cys-Cys), member 14
  • RSS
  • YouTube
  • Linkedin
  • Facebook