Product Browser

Last updated: 2017/7/23
  • Related Product Showcase
  • By Research Area

  • By Pathway

  • By Biomarker

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL14 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00006358-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human CCL14 protein.
  • Immunogen:
  • CCL14 (NP_004157.1, 1 a.a. ~ 93 a.a) full-length human protein.
  • Sequence:
  • MKISVAAIPFFLLITIALGTKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CCL14 expression in transfected 293T cell line (H00006358-T02) by CCL14 MaxPab polyclonal antibody.

    Lane 1: CCL14 transfected lysate(10.70 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6358
  • Gene Name:
  • CCL14
  • Gene Alias:
  • CC-1,CC-3,CKb1,HCC-1,HCC-3,MCIF,NCC-2,NCC2,SCYA14,SCYL2,SY14
  • Gene Description:
  • chemokine (C-C motif) ligand 14
  • Gene Summary:
  • This gene, CCL14, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene induces changes in intracellular calcium concentration and enzyme release in monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Read-through transcripts are also expressed that include exons from the upstream cytokine gene CCL15, and are represented as GeneID: 348249. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000176860,chemokine CC-1,chemokine CC-3,small inducible cytokine subfamily A (Cys-Cys), member 14
  • RSS
  • YouTube
  • Linkedin
  • Facebook