Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Pathway

  • By Biomarker

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL13 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00006357-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human CCL13 protein.
  • Immunogen:
  • CCL13 (NP_005399.1, 1 a.a. ~ 98 a.a) full-length human protein.
  • Sequence:
  • MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CCL13 expression in transfected 293T cell line (H00006357-T02) by CCL13 MaxPab polyclonal antibody.

    Lane 1: CCL13 transfected lysate(11.00 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6357
  • Gene Name:
  • CCL13
  • Gene Alias:
  • CKb10,MCP-4,MGC17134,NCC-1,NCC1,SCYA13,SCYL1
  • Gene Description:
  • chemokine (C-C motif) ligand 13
  • Gene Summary:
  • This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. This chemokine plays a role in accumulation of leukocytes during inflammation. It may also be involved in the recruitment of monocytes into the arterial wall during artherosclerosis. [provided by RefSeq
  • Other Designations:
  • CK-beta-10,monocyte chemoattractant protein 4,monocyte chemotactic protein 4,new CC chemokine 1,small inducible cytokine A13,small inducible cytokine subfamily A (Cys-Cys), member 13
  • RSS
  • YouTube
  • Linkedin
  • Facebook