Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL13 polyclonal antibody (A01)

  • Catalog # : H00006357-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant CCL13.
  • Immunogen:
  • CCL13 (AAH08621, 1 a.a. ~ 98 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006357-A01
    Western Blot detection against Immunogen (36.89 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6357
  • Gene Name:
  • CCL13
  • Gene Alias:
  • CKb10,MCP-4,MGC17134,NCC-1,NCC1,SCYA13,SCYL1
  • Gene Description:
  • chemokine (C-C motif) ligand 13
  • Gene Summary:
  • This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. This chemokine plays a role in accumulation of leukocytes during inflammation. It may also be involved in the recruitment of monocytes into the arterial wall during artherosclerosis. [provided by RefSeq
  • Other Designations:
  • CK-beta-10,monocyte chemoattractant protein 4,monocyte chemotactic protein 4,new CC chemokine 1,small inducible cytokine A13,small inducible cytokine subfamily A (Cys-Cys), member 13
  • RSS
  • YouTube
  • Linkedin
  • Facebook