CCL1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CCL1 protein.
Immunogen
CCL1 (NP_002972.1, 1 a.a. ~ 96 a.a) full-length human protein.
Sequence
MQIITTALVCLLLAGMWPEDVDSKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (42); Rat (43)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CCL1 MaxPab rabbit polyclonal antibody. Western Blot analysis of CCL1 expression in A-431.Western Blot (Transfected lysate)
Western Blot analysis of CCL1 expression in transfected 293T cell line (H00006346-T01) by CCL1 MaxPab polyclonal antibody.
Lane 1: CCL1 transfected lysate(11.00 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CCL1
Entrez GeneID
6346GeneBank Accession#
NM_002981Protein Accession#
NP_002972.1Gene Name
CCL1
Gene Alias
I-309, P500, SCYA1, SISe, TCA3
Gene Description
chemokine (C-C motif) ligand 1
Omim ID
182281Gene Ontology
HyperlinkGene Summary
This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine is secreted by activated T cells and displays chemotactic activity for monocytes but not for neutrophils. It binds to the chemokine receptor CCR8. [provided by RefSeq
Other Designations
T lymphocyte-secreted protein I-309|inflammatory cytokine I-309|small inducible cytokine A1|small inducible cytokine A1 (I-309, homologous to mouse Tca-3)
-
Interactome
-
Pathway
-
Disease
- Adenocarcinoma
- Arthritis
- Asthma
- Atherosclerosis
- Birth Weight
- Breast cancer
- Breast Neoplasms
- Bronchiolitis
- Colon cancer
+ View More Disease
-
Publication Reference
-
Toxin-induced RhoA activity mediates CCL1-triggered signal transducers and activators of transcription protein signaling.
Reipschläger S, Kubatzky K, Taromi S, Burger M, Orth J, Aktories K, Schmidt G.
The Journal of Biological Chemistry 2012 Mar; 287(14):11183.
Application:WB, Human, HEK 293 cells.
-
Toxin-induced RhoA activity mediates CCL1-triggered signal transducers and activators of transcription protein signaling.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com