SCP2 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human SCP2 protein.
Immunogen
SCP2 (NP_001007099, 1 a.a. ~ 322 a.a) full-length human protein.
Sequence
MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPYSAVDQACVGYVFGVAECVLALGFEKMSKGSLGIKFSDRTIPTDKHVDLLINKYGLSAHPVAPQMFGYAGKEHMEKYGTKIEHFAKIGWKNHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILASEAFVQKYGLQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDMSKEAARKCYEKSGLTPNDIDVIELHDCFSTNELLTYEALGLCPEGQGATLVDRGDNTYGGKWVINPSGGLISKGHPLGATGGHSCS
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SCP2 MaxPab polyclonal antibody. Western Blot analysis of SCP2 expression in human liver.Western Blot (Cell lysate)
SCP2 MaxPab polyclonal antibody. Western Blot analysis of SCP2 expression in A-431.Western Blot (Transfected lysate)
Western Blot analysis of SCP2 expression in transfected 293T cell line (H00006342-T01) by SCP2 MaxPab polyclonal antibody.
Lane 1: SCP2 transfected lysate(35.42 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — SCP2
Entrez GeneID
6342GeneBank Accession#
NM_001007098Protein Accession#
NP_001007099Gene Name
SCP2
Gene Alias
DKFZp686C12188, DKFZp686D11188, NLTP, NSL-TP, SCPX
Gene Description
sterol carrier protein 2
Omim ID
184755Gene Ontology
HyperlinkGene Summary
This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer SCPx protein, and the transcript initiated from the distal promoter encodes the shorter SCP2 protein, with the 2 proteins sharing a common C-terminus. Evidence suggests that the SCPx protein is a peroxisome-associated thiolase that is involved in the oxidation of branched chain fatty acids, while the SCP2 protein is thought to be an intracellular lipid transfer protein. This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms. The full-length nature of all transcript variants has not been determined. [provided by RefSeq
Other Designations
OTTHUMP00000010488|nonspecific lipid-transfer protein|sterol carrier protein X
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com