Product Browser

Last updated: 2017/7/23
  • Related Product Showcase
  • By Research Area

  • By Pathway

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SCN9A monoclonal antibody (M01), clone 5A11

  • Catalog # : H00006335-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant SCN9A.
  • Immunogen:
  • SCN9A (NP_002968, 269 a.a. ~ 339 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • GNLKHKCFRNSLENNETLESIMNTLESEEDFRKYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNPDY
  • Host:
  • Mouse
  • Reactivity:
  • Human, Rat
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006335-M01
    Western Blot detection against Immunogen (33.55 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • SCN9A monoclonal antibody (M01), clone 5A11. Western Blot analysis of SCN9A expression in rat testis.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged SCN9A is approximately 10ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6335
  • Gene Name:
  • SCN9A
  • Gene Alias:
  • ETHA,NE-NA,NENA,Nav1.7,PN1
  • Gene Description:
  • sodium channel, voltage-gated, type IX, alpha subunit
  • Gene Summary:
  • This gene encodes a voltage-gated sodium channel which plays a significant role in nociception signaling. Mutations in this gene have been associated with primary erythermalgia, channelopathy-associated insensitivity to pain, and paroxysmal extreme pain disorder. [provided by RefSeq
  • Other Designations:
  • sodium channel, voltage-gated, type IX, alpha,sodium channel, voltage-gated, type IX, alpha polypeptide,voltage-gated sodium channel alpha subunit Nav1.7
  • RSS
  • YouTube
  • Linkedin
  • Facebook