SCN8A monoclonal antibody (M04), clone 4G7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant SCN8A.
Immunogen
SCN8A (NP_055006, 1854 a.a. ~ 1951 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFICKKTTSNKLENGGTHREKKESTPSTASLPSYDSVT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (96)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SCN8A is 0.03 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to SCN8A on NIH/3T3 cell. [antibody concentration 10 ug/ml] -
Gene Info — SCN8A
Entrez GeneID
6334GeneBank Accession#
NM_014191Protein Accession#
NP_055006Gene Name
SCN8A
Gene Alias
CerIII, MED, NaCh6, Nav1.6, PN4
Gene Description
sodium channel, voltage gated, type VIII, alpha subunit
Omim ID
600702Gene Ontology
HyperlinkGene Summary
Voltage-dependent sodium channels, such as SCN8A, are responsible for the initial membrane depolarization that occurs during generation of action potentials in most electrically excitable cells (Plummer et al., 1998 [PubMed 9828131]).[supplied by OMIM
Other Designations
hNa6/Scn8a voltage-gated sodium channel|motor endplate disease|sodium channel voltage-gated type VIII alpha|sodium channel, voltage gated, type VIII, alpha|sodium channel, voltage gated, type VIII, alpha polypeptide|voltage-gated sodium channel Nav1.6|vol
-
Interactomes
-
Diseases
-
Publication Reference
-
Nav1.1 localizes to axons of parvalbumin-positive inhibitory interneurons: a circuit basis for epileptic seizures in mice carrying an Scn1a gene mutation.
Ogiwara I, Miyamoto H, Morita N, Atapour N, Mazaki E, Inoue I, Takeuchi T, Itohara S, Yanagawa Y, Obata K, Furuichi T, Hensch TK, Yamakawa K.
Journal of Neuroscience 2007 May; 27(22):5903.
Application:WB, Mouse, Mouse brain.
-
Nav1.1 localizes to axons of parvalbumin-positive inhibitory interneurons: a circuit basis for epileptic seizures in mice carrying an Scn1a gene mutation.
- +1-404-910-4762
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com