Product Browser

Last updated: 2017/7/23
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SCN8A monoclonal antibody (M04), clone 4G7

  • Catalog # : H00006334-M04
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant SCN8A.
  • Immunogen:
  • SCN8A (NP_055006, 1854 a.a. ~ 1951 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • RVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFICKKTTSNKLENGGTHREKKESTPSTASLPSYDSVT
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006334-M04
    Western Blot detection against Immunogen (36.52 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6334
  • Gene Name:
  • SCN8A
  • Gene Alias:
  • CerIII,MED,NaCh6,Nav1.6,PN4
  • Gene Description:
  • sodium channel, voltage gated, type VIII, alpha subunit
  • Gene Summary:
  • Voltage-dependent sodium channels, such as SCN8A, are responsible for the initial membrane depolarization that occurs during generation of action potentials in most electrically excitable cells (Plummer et al., 1998 [PubMed 9828131]).[supplied by OMIM
  • Other Designations:
  • hNa6/Scn8a voltage-gated sodium channel,motor endplate disease,sodium channel voltage-gated type VIII alpha,sodium channel, voltage gated, type VIII, alpha,sodium channel, voltage gated, type VIII, alpha polypeptide,voltage-gated sodium channel Nav1.6,vol
  • RSS
  • YouTube
  • Linkedin
  • Facebook