SCN3A (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SCN3A partial ORF ( NP_008853, 1861 a.a. - 1960 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
LCESGEMDALRIQMEDRFMASNPSKVSYEPITTTLKRKQEEVSAAIIQRNFRCYLLKQRLKNISSNYNKEAIKGRIDLPIKQDMIIDKLNGNSTPEKTDG
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Interspecies Antigen Sequence
Mouse (91)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SCN3A
Entrez GeneID
6328GeneBank Accession#
NM_006922Protein Accession#
NP_008853Gene Name
SCN3A
Gene Alias
KIAA1356, NAC3, Nav1.3
Gene Description
sodium channel, voltage-gated, type III, alpha subunit
Omim ID
182391Gene Ontology
HyperlinkGene Summary
Voltage-gated sodium channels are transmembrane glycoprotein complexes composed of a large alpha subunit with 24 transmembrane domains and one or more regulatory beta subunits. They are responsible for the generation and propagation of action potentials in neurons and muscle. This gene encodes one member of the sodium channel alpha subunit gene family, and is found in a cluster of five alpha subunit genes on chromosome 2. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000041047|brain III voltage-gated sodium channel|sodium channel protein type 3 subunit alpha|sodium channel, voltage-gated, type III, alpha|sodium channel, voltage-gated, type III, alpha polypeptide
-
Interactome
-
Disease
-
Publication Reference
-
Knockdown of rno_circRNA_009194 Improves Outcomes in Traumatic Brain Injury Rats Through Inhibiting Voltage-gated Sodium Channel Nav1.3.
Xian-Jian Huang, Gao-Jian Su, Chu-Wei Wu, Xiao-Song Sha, Jun-Feng Zou, Xian-Sheng Liu, Min Li, Yun He.
Journal of Neurotrauma 2022 Jan; 39(1-2):196.
Application:WB-Re, Rat, Rat neurons.
-
Knockdown of rno_circRNA_009194 Improves Outcomes in Traumatic Brain Injury Rats Through Inhibiting Voltage-gated Sodium Channel Nav1.3.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com