Product Browser

Last updated: 2017/8/13
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SERPINB3 monoclonal antibody (M01), clone 2F5

  • Catalog # : H00006317-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant SERPINB3.
  • Immunogen:
  • SERPINB3 (NP_008850, 276 a.a. ~ 390 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • RETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006317-M01
    Western Blot detection against Immunogen (38.39 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SERPINB3 expression in transfected 293T cell line by SERPINB3 monoclonal antibody (M01), clone 2F5.

    Lane 1: SERPINB3 transfected lysate(44.6 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of SERPINB3 transfected lysate using anti-SERPINB3 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SERPINB3 MaxPab rabbit polyclonal antibody.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged SERPINB3 is approximately 0.3ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6317
  • Gene Name:
  • SERPINB3
  • Gene Alias:
  • HsT1196,SCC,SCCA-1,SCCA-PD,SCCA1,T4-A
  • Gene Description:
  • serpin peptidase inhibitor, clade B (ovalbumin), member 3
  • Other Designations:
  • serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3,squamous cell carcinoma antigen 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook