Product Browser

Last updated: 2016/11/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SERPINB3 MaxPab rabbit polyclonal antibody (D03)MaxPab

  • Catalog # : H00006317-D03
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human SERPINB3 protein.
  • Immunogen:
  • SERPINB3 (AAH05224.1, 1 a.a. ~ 390 a.a) full-length human protein.
  • Sequence:
  • MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SERPINB3 expression in transfected 293T cell line (H00006317-T03) by SERPINB3 MaxPab polyclonal antibody.

    Lane 1: SERPINB3 transfected lysate(42.9 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of SERPINB3 transfected lysate using anti-SERPINB3 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SERPINB3 purified MaxPab mouse polyclonal antibody (B02P) (H00006317-B02P).
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6317
  • Gene Name:
  • SERPINB3
  • Gene Alias:
  • HsT1196,SCC,SCCA-1,SCCA-PD,SCCA1,T4-A
  • Gene Description:
  • serpin peptidase inhibitor, clade B (ovalbumin), member 3
  • Other Designations:
  • serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3,squamous cell carcinoma antigen 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook