Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SAT (Human) Recombinant Protein (P01)

  • Catalog # : H00006303-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SAT full-length ORF ( AAH02503, 1 a.a. - 171 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 44.55
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006303-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6303
  • Gene Name:
  • SAT1
  • Gene Alias:
  • DC21,KFSD,SAT,SSAT,SSAT-1
  • Gene Description:
  • spermidine/spermine N1-acetyltransferase 1
  • Gene Summary:
  • The protein encoded by this gene belongs to the acetyltransferase family, and is a rate-limiting enzyme in the catabolic pathway of polyamine metabolism. It catalyzes the acetylation of spermidine and spermine, and is involved in the regulation of the intracellular concentration of polyamines and their transport out of cells. Defects in this gene are associated with keratosis follicularis spinulosa decalvans (KFSD). Alternatively spliced transcripts have been found for this gene
  • Other Designations:
  • OTTHUMP00000023061,diamine acetyltransferase 1,spermidine/spermine N1-acetyltransferase,spermidine/spermine N1-acetyltransferase alpha
  • RSS
  • YouTube
  • Linkedin
  • Facebook